SCOPe 2.01: Domain d1if1b_: 1if1 B:

Lineage for d1if1b_ (1if1 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
   Pfam PF00605

6. Protein Interferon regulatory factor 1 (IRF-1) [46878] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46879] (1 PDB entry)

8. Domain d1if1b_: 1if1 B: [16184]
   protein/DNA complex

Details for d1if1b_

PDB Entry: 1if1, 3 Å

PDB Description: interferon regulatory factor 1 (irf-1) complex with dna

PDB Compounds: (B:) protein (interferon regulatory factor 1)

SCOPe Domain Sequences for d1if1b_:

Sequence; same for both SEQRES and ATOM records:

>d1if1b_ a.4.5.23 (B:) Interferon regulatory factor 1 (IRF-1) {Mouse (Mus musculus) [TaxId: 10090]}
mrpwlemqinsnqipgliwinkeemifqipwkhaakhgwdinkdaclfrswaihtgryka
gekepdpktwkanfrcamnslpdieevkdqsrnkgssavrvyrm

Timeline for d1if1b_:

• d1if1b_ first appeared (with stable ids) in SCOP 1.55
  
• d1if1b_ appears in SCOP 1.75
  
• d1if1b_ appears in SCOPe 2.02
  
• d1if1b_ appears in the current release, SCOPe 2.08