Lineage for d1if1b_ (1if1 B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762298Family a.4.5.23: Interferon regulatory factor [46877] (3 proteins)
    Pfam PF00605
  6. 762299Protein Interferon regulatory factor 1 (IRF-1) [46878] (1 species)
  7. 762300Species Mouse (Mus musculus) [TaxId:10090] [46879] (1 PDB entry)
  8. 762302Domain d1if1b_: 1if1 B: [16184]
    protein/DNA complex

Details for d1if1b_

PDB Entry: 1if1 (more details), 3 Å

PDB Description: interferon regulatory factor 1 (irf-1) complex with dna
PDB Compounds: (B:) protein (interferon regulatory factor 1)

SCOP Domain Sequences for d1if1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1if1b_ a.4.5.23 (B:) Interferon regulatory factor 1 (IRF-1) {Mouse (Mus musculus) [TaxId: 10090]}
mrpwlemqinsnqipgliwinkeemifqipwkhaakhgwdinkdaclfrswaihtgryka
gekepdpktwkanfrcamnslpdieevkdqsrnkgssavrvyrm

SCOP Domain Coordinates for d1if1b_:

Click to download the PDB-style file with coordinates for d1if1b_.
(The format of our PDB-style files is described here.)

Timeline for d1if1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1if1a_