SCOPe 2.06: Domain d1puef_: 1pue F:

Lineage for d1puef_ (1pue F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein Transcription factor PU.1, residues 171-259 [46865] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46866] (1 PDB entry)

8. Domain d1puef_: 1pue F: [16166]
   protein/DNA complex

Details for d1puef_

PDB Entry: 1pue, 2.1 Å

PDB Description: pu.1 ets domain-dna complex

PDB Compounds: (F:) protein (transcription factor pu.1 (tf pu.1))

SCOPe Domain Sequences for d1puef_:

Sequence; same for both SEQRES and ATOM records:

>d1puef_ a.4.5.21 (F:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]}
kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
aralrnygktgevkkvkkkltyqfsgevl

Timeline for d1puef_:

• d1puef_ first appeared (with stable ids) in SCOP 1.55
  
• d1puef_ appears in SCOPe 2.05
  
• d1puef_ appears in SCOPe 2.07
  
• d1puef_ appears in the current release, SCOPe 2.08