Lineage for d1puef_ (1pue F:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) 
Family a.4.5.21: ets domain [46859] (6 proteins) 
Protein Transcription factor PU.1, residues 171-259 [46865] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [46866] (1 PDB entry) 
Domain d1puef_: 1pue F: [16166]
Details for d1puef_
PDB Entry: 1pue (more details), 2.1 Å
PDB Description: pu.1 ets domain-dna complex
SCOP Domain Sequences for d1puef_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1puef_ a.4.5.21 (F:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus)}
kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
aralrnygktgevkkvkkkltyqfsgevl
SCOP Domain Coordinates for d1puef_:
Click to download the PDB-style file with coordinates for d1puef_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1puef_:
- d1puef_ appears in SCOP 1.57
- d1puef_ appears in the current release, SCOPe 2.08
View in 3D
