Lineage for d3d1md_ (3d1m D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2372165Protein automated matches [190888] (2 species)
    not a true protein
  7. 2372168Species Human (Homo sapiens) [TaxId:9606] [188282] (32 PDB entries)
  8. 2372190Domain d3d1md_: 3d1m D: [161637]
    Other proteins in same PDB: d3d1ma_, d3d1mb_
    automated match to d1x4ya1
    complexed with ca, zn

Details for d3d1md_

PDB Entry: 3d1m (more details), 1.7 Å

PDB Description: crystal structure of sonic hedgehog bound to the third fniii domain of cdo
PDB Compounds: (D:) Cell adhesion molecule

SCOPe Domain Sequences for d3d1md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d1md_ b.1.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pitgphiayteavsdtqimlkwtyipssnnntpiqgfyiyyrptdsdndsdykrdvvegs
kqwhmighlqpetsydikmqcfneggesefsnvmicetk

SCOPe Domain Coordinates for d3d1md_:

Click to download the PDB-style file with coordinates for d3d1md_.
(The format of our PDB-style files is described here.)

Timeline for d3d1md_: