Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) |
Family d.278.1.2: TRAPP components [118076] (3 proteins) Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold |
Protein automated matches [190535] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187891] (4 PDB entries) |
Domain d2j3wd_: 2j3w D: [161467] Other proteins in same PDB: d2j3wa_, d2j3wb1, d2j3wc_, d2j3wf_ automated match to d1wc8a_ complexed with plm |
PDB Entry: 2j3w (more details), 2.1 Å
SCOPe Domain Sequences for d2j3wd_:
Sequence, based on SEQRES records: (download)
>d2j3wd_ d.278.1.2 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdfr etadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllc gvlrgalemvqmaveakfvqdtlkgdgvteirmrfirried
>d2j3wd_ d.278.1.2 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnchdfreta dviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllcgvl rgalemvqmaveakfvqdtlkgdgvteirmrfirried
Timeline for d2j3wd_: