Lineage for d2hoa__ (2hoa -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277522Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 277523Family a.4.1.1: Homeodomain [46690] (21 proteins)
  6. 277524Protein Antennapedia Homeodomain [46716] (1 species)
  7. 277525Species Drosophila melanogaster [TaxId:7227] [46717] (5 PDB entries)
  8. 277531Domain d2hoa__: 2hoa - [16009]
    mutant

Details for d2hoa__

PDB Entry: 2hoa (more details)

PDB Description: structure determination of the antp(c39->s) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs diana, caliba, habas and glomsa

SCOP Domain Sequences for d2hoa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hoa__ a.4.1.1 (-) Antennapedia Homeodomain {Drosophila melanogaster}
mrkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkke
nktkgepg

SCOP Domain Coordinates for d2hoa__:

Click to download the PDB-style file with coordinates for d2hoa__.
(The format of our PDB-style files is described here.)

Timeline for d2hoa__: