Class a: All alpha proteins [46456] (179 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (11 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (21 proteins) |
Protein Antennapedia Homeodomain [46716] (1 species) |
Species Drosophila melanogaster [TaxId:7227] [46717] (5 PDB entries) |
Domain d2hoa__: 2hoa - [16009] mutant |
PDB Entry: 2hoa (more details)
SCOP Domain Sequences for d2hoa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hoa__ a.4.1.1 (-) Antennapedia Homeodomain {Drosophila melanogaster} mrkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkke nktkgepg
Timeline for d2hoa__: