Lineage for d2hoa__ (2hoa -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (9 families) 
Family a.4.1.1: Homeodomain [46690] (18 proteins) 
Protein Antennapedia Homeodomain [46716] (1 species) Species Drosophila melanogaster [TaxId:7227] [46717] (5 PDB entries) 
Domain d2hoa__: 2hoa - [16009]
Details for d2hoa__
PDB Entry: 2hoa (more details)
PDB Description: structure determination of the antp(c39->s) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs diana, caliba, habas and glomsa
SCOP Domain Sequences for d2hoa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hoa__ a.4.1.1 (-) Antennapedia Homeodomain {Drosophila melanogaster}
mrkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkke
nktkgepg
SCOP Domain Coordinates for d2hoa__:
Click to download the PDB-style file with coordinates for d2hoa__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hoa__:
- d2hoa__ appears in SCOP 1.57
- d2hoa__ appears in the current release, SCOPe 2.08, called d2hoaa1
View in 3D