Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins) |
Protein Uncharacterized protein BTHI0051 [159973] (1 species) |
Species Burkholderia thailandensis [TaxId:57975] [159974] (1 PDB entry) Uniprot Q2T2I4 10-139 |
Domain d3ec9b_: 3ec9 B: [158093] automated match to d3ec9a1 complexed with act, gol |
PDB Entry: 3ec9 (more details), 1.6 Å
SCOPe Domain Sequences for d3ec9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ec9b_ d.17.4.10 (B:) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} mmrtpyqivadhyaasdrhdpaammadiapaiewtemagfpcagtyrsadeivrnvfrrl geewdgytfkldalhdagdtvigvgrysgtyrrtgksfecrvahvwrvdagkivhfeqft dtllvaqamqp
Timeline for d3ec9b_: