Lineage for d3ec9a1 (3ec9 A:10-139)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheetSuperfamily d.17.4: NTF2-like [54427] (31 families) 
has a beta-alpha(2)-beta insertion after the main helix
Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins) 
Protein Uncharacterized protein BTHI0051 [159973] (1 species) Species Burkholderia thailandensis [TaxId:57975] [159974] (1 PDB entry)
Uniprot Q2T2I4 10-139
Domain d3ec9a1: 3ec9 A:10-139 [158092]
complexed with act, gol
Details for d3ec9a1
PDB Entry: 3ec9 (more details), 1.6 Å
PDB Description: crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution
PDB Compounds: (A:) uncharacterized NTF2-like proteinSCOPe Domain Sequences for d3ec9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]}
mrtpyqivadhyaasdrhdpaammadiapaiewtemagfpcagtyrsadeivrnvfrrlg
eewdgytfkldalhdagdtvigvgrysgtyrrtgksfecrvahvwrvdagkivhfeqftd
tllvaqamqp
SCOPe Domain Coordinates for d3ec9a1:
Click to download the PDB-style file with coordinates for d3ec9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ec9a1:
- d3ec9a1 first appeared in SCOP 1.75
- d3ec9a1 appears in SCOPe 2.07
View in 3D
