Lineage for d3dtub2 (3dtu B:29-129)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956758Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 1956780Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1956781Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1956782Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 1956788Species Rhodobacter sphaeroides [TaxId:1063] [81457] (6 PDB entries)
  8. 1956789Domain d3dtub2: 3dtu B:29-129 [157858]
    Other proteins in same PDB: d3dtua_, d3dtub1, d3dtuc_, d3dtud1
    automated match to d3fyeb1
    complexed with ca, cd, cu, dmu, dxc, hea, hto, mg, oh, po4, trd

Details for d3dtub2

PDB Entry: 3dtu (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides complexed with deoxycholic acid
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3dtub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dtub2 f.17.2.1 (B:29-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
sleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrn
kvparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOPe Domain Coordinates for d3dtub2:

Click to download the PDB-style file with coordinates for d3dtub2.
(The format of our PDB-style files is described here.)

Timeline for d3dtub2: