Lineage for d3dtua_ (3dtu A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958596Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 1958597Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 1958598Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 1958599Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species)
  7. 1958603Species Rhodobacter sphaeroides [TaxId:1063] [81435] (6 PDB entries)
  8. 1958604Domain d3dtua_: 3dtu A: [157856]
    Other proteins in same PDB: d3dtub1, d3dtub2, d3dtud1, d3dtud2
    automated match to d1m56a_
    complexed with ca, cd, cu, dmu, dxc, hea, hto, mg, oh, po4, trd

Details for d3dtua_

PDB Entry: 3dtu (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides complexed with deoxycholic acid
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3dtua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dtua_ f.24.1.1 (A:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]}
rrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesgl
vkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapd
mafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaif
avhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitm
lltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifg
ylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwg
gsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgi
fagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafat
wnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf

SCOPe Domain Coordinates for d3dtua_:

Click to download the PDB-style file with coordinates for d3dtua_.
(The format of our PDB-style files is described here.)

Timeline for d3dtua_: