SCOPe 2.02: Domain d3d87d1: 3d87 D:1-87

Lineage for d3d87d1 (3d87 D:1-87)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63666] (5 PDB entries)

8. Domain d3d87d1: 3d87 D:1-87 [157445]
   Other proteins in same PDB: d3d87b2, d3d87b3, d3d87d2, d3d87d3
   automatically matched to d1f42a1
   complexed with k, man, po4

Details for d3d87d1

PDB Entry: 3d87, 2.9 Å

PDB Description: crystal structure of interleukin-23

PDB Compounds: (D:) Interleukin-12 subunit p40

SCOPe Domain Sequences for d3d87d1:

Sequence; same for both SEQRES and ATOM records:

>d3d87d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked

Timeline for d3d87d1:

• d3d87d1 first appeared in SCOP 1.75
  
• d3d87d1 appears in SCOPe 2.01
  
• d3d87d1 appears in SCOPe 2.03
  
• d3d87d1 appears in the current release, SCOPe 2.08