Lineage for d3d5co1 (3d5c O:2-89)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896972Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 897050Domain d3d5co1: 3d5c O:2-89 [157378]
    Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cn1, d3d5cq1, d3d5cr1, d3d5ct1, d3d5cu1
    automatically matched to d1eg0f_
    complexed with mg, zn

Details for d3d5co1

PDB Entry: 3d5c (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d3d5co1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5co1 i.1.1.1 (O:2-89) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d3d5co1:

Click to download the PDB-style file with coordinates for d3d5co1.
(The format of our PDB-style files is described here.)

Timeline for d3d5co1: