![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
![]() | Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() |
![]() | Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
![]() | Protein Ribosomal protein S8 [56049] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
![]() | Domain d3d5ch1: 3d5c H:1-138 [157372] Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cr1, d3d5cs1, d3d5ct1, d3d5cu1 automatically matched to d1fjgh_ complexed with mg, zn |
PDB Entry: 3d5c (more details), 3.21 Å
SCOP Domain Sequences for d3d5ch1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5ch1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d3d5ch1: