Lineage for d3d5ct1 (3d5c T:8-106)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764036Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 764037Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 764038Protein Ribosomal protein S20 [46994] (2 species)
  7. 764066Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 764089Domain d3d5ct1: 3d5c T:8-106 [157383]
    Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cr1, d3d5cs1, d3d5cu1
    automatically matched to d1fjgt_
    complexed with mg, zn

Details for d3d5ct1

PDB Entry: 3d5c (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOP Domain Sequences for d3d5ct1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ct1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d3d5ct1:

Click to download the PDB-style file with coordinates for d3d5ct1.
(The format of our PDB-style files is described here.)

Timeline for d3d5ct1: