Class a: All alpha proteins [46456] (284 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein) consists of four heme-binding repeats |
Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [48709] (15 PDB entries) |
Domain d3d38c1: 3d38 C:1-332 [157273] Other proteins in same PDB: d3d38h1, d3d38h2, d3d38l1, d3d38m1 automatically matched to d1prcc_ complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1 |
PDB Entry: 3d38 (more details), 3.21 Å
SCOPe Domain Sequences for d3d38c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d38c1 a.138.1.2 (C:1-332) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]} cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea pqadcrtchqgvtkplfgasrlkdypelgpik
Timeline for d3d38c1:
View in 3D Domains from other chains: (mouse over for more information) d3d38h1, d3d38h2, d3d38l1, d3d38m1 |