Lineage for d3d38c1 (3d38 C:1-332)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778525Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 778526Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 778598Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
    consists of four heme-binding repeats
  6. 778599Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 778600Species Rhodopseudomonas viridis [TaxId:1079] [48709] (11 PDB entries)
  8. 778611Domain d3d38c1: 3d38 C:1-332 [157273]
    Other proteins in same PDB: d3d38h1, d3d38h2, d3d38l1, d3d38m1
    automatically matched to d1prcc_
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1

Details for d3d38c1

PDB Entry: 3d38 (more details), 3.21 Å

PDB Description: Crystal structure of new trigonal form of photosynthetic reaction center from Blastochloris viridis. Crystals grown in microfluidics by detergent capture.
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOP Domain Sequences for d3d38c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d38c1 a.138.1.2 (C:1-332) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOP Domain Coordinates for d3d38c1:

Click to download the PDB-style file with coordinates for d3d38c1.
(The format of our PDB-style files is described here.)

Timeline for d3d38c1: