SCOPe 2.05: Domain d3d31b1: 3d31 B:230-348

Lineage for d3d31b1 (3d31 B:230-348)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.0: automated matches [254223] (1 protein)
   not a true family

6. Protein automated matches [254506] (2 species)
   not a true protein

7. Species Methanosarcina acetivorans [TaxId:2214] [255794] (1 PDB entry)

8. Domain d3d31b1: 3d31 B:230-348 [157263]
   Other proteins in same PDB: d3d31a1, d3d31a2, d3d31b2, d3d31c1, d3d31d1
   automated match to d3d31a1
   complexed with wo4

Details for d3d31b1

PDB Entry: 3d31, 3 Å

PDB Description: modbc from methanosarcina acetivorans

PDB Compounds: (B:) Sulfate/molybdate ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d3d31b1:

Sequence; same for both SEQRES and ATOM records:

>d3d31b1 b.40.6.0 (B:230-348) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
fenvlkgrvisaeqgllrirvgevvidaagdmevgdqvyaflrpenialsksstqssirn
slqgrvteawvlgalvrvkvdcgvplnvlitrrsaeemelspgvqiyarfkassvhvlr

Timeline for d3d31b1:

• d3d31b1 first appeared in SCOP 1.75
  
• d3d31b1 appears in SCOPe 2.04
  
• d3d31b1 appears in SCOPe 2.06
  
• d3d31b1 appears in the current release, SCOPe 2.08