Lineage for d3cxhp2 (3cxh P:31-86)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059867Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 1059868Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 1059869Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 1059870Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (7 PDB entries)
  8. 1059877Domain d3cxhp2: 3cxh P:31-86 [157134]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhf1, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhq1, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
    automatically matched to d1ezve2
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, suc, umq

Details for d3cxhp2

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (P:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3cxhp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhp2 f.23.12.1 (P:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOPe Domain Coordinates for d3cxhp2:

Click to download the PDB-style file with coordinates for d3cxhp2.
(The format of our PDB-style files is described here.)

Timeline for d3cxhp2: