Lineage for d3cxhp2 (3cxh P:31-86)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887478Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 887479Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 887480Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 887481Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (7 PDB entries)
  8. 887488Domain d3cxhp2: 3cxh P:31-86 [157134]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhf1, d3cxhg1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhq1, d3cxhr1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1
    automatically matched to d1ezve2
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq

Details for d3cxhp2

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (P:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOP Domain Sequences for d3cxhp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhp2 f.23.12.1 (P:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOP Domain Coordinates for d3cxhp2:

Click to download the PDB-style file with coordinates for d3cxhp2.
(The format of our PDB-style files is described here.)

Timeline for d3cxhp2: