SCOPe 2.06: Domain d3clrc_: 3clr C:

Lineage for d3clrc_ (3clr C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (3 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
   binds AMP

7. Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries)

8. Domain d3clrc_: 3clr C: [156754]
   Other proteins in same PDB: d3clrd1, d3clrd2
   automated match to d1o96a_
   complexed with amp, fad, po4; mutant

Details for d3clrc_

PDB Entry: 3clr, 1.9 Å

PDB Description: crystal structure of the r236a etf mutant from m. methylotrophus

PDB Compounds: (C:) Electron transfer flavoprotein subunit beta

SCOPe Domain Sequences for d3clrc_:

Sequence, based on SEQRES records:

>d3clrc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
tmiegtiseqaakiiqiinefk

Sequence, based on observed residues (ATOM records):

>d3clrc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryastkpieevsladiglsandvgaaqsmsrvrrmyipekgratmiegtis
eqaakiiqiinefk

Timeline for d3clrc_:

• d3clrc_ first appeared in SCOP 1.75, called d3clrc1
  
• d3clrc_ appears in SCOPe 2.05
  
• d3clrc_ appears in SCOPe 2.07
  
• d3clrc_ appears in the current release, SCOPe 2.08