Lineage for d3clrc_ (3clr C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842395Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 1842417Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 1842422Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries)
  8. 1842426Domain d3clrc_: 3clr C: [156754]
    Other proteins in same PDB: d3clrd1, d3clrd2
    automated match to d1o96a_
    complexed with amp, fad, po4; mutant

Details for d3clrc_

PDB Entry: 3clr (more details), 1.9 Å

PDB Description: crystal structure of the r236a etf mutant from m. methylotrophus
PDB Compounds: (C:) Electron transfer flavoprotein subunit beta

SCOPe Domain Sequences for d3clrc_:

Sequence, based on SEQRES records: (download)

>d3clrc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
tmiegtiseqaakiiqiinefk

Sequence, based on observed residues (ATOM records): (download)

>d3clrc_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryastkpieevsladiglsandvgaaqsmsrvrrmyipekgratmiegtis
eqaakiiqiinefk

SCOPe Domain Coordinates for d3clrc_:

Click to download the PDB-style file with coordinates for d3clrc_.
(The format of our PDB-style files is described here.)

Timeline for d3clrc_: