SCOPe 2.03: Domain d3ccmi1: 3ccm I:66-129

Lineage for d3ccmi1 (3ccm I:66-129)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
   Uniprot P14122 67-136

8. Domain d3ccmi1: 3ccm I:66-129 [156339]
   Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmf1, d3ccmh1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccmr1, d3ccms1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1, d3ccmz1
   automatically matched to d1s72i_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccmi1

PDB Entry: 3ccm, 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d3ccmi1:

Sequence; same for both SEQRES and ATOM records:

>d3ccmi1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

Timeline for d3ccmi1:

• d3ccmi1 first appeared in SCOP 1.75
  
• d3ccmi1 appears in SCOPe 2.02
  
• d3ccmi1 appears in SCOPe 2.04
  
• d3ccmi1 appears in the current release, SCOPe 2.08