Lineage for d3ccmf1 (3ccm F:1-119)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1421026Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 1421027Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1421044Protein Ribosomal protein L7ae [55319] (7 species)
  7. 1421052Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 1421066Domain d3ccmf1: 3ccm F:1-119 [156337]
    Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccmr1, d3ccms1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1, d3ccmz1
    automatically matched to d1s72f_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccmf1

PDB Entry: 3ccm (more details), 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d3ccmf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccmf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d3ccmf1:

Click to download the PDB-style file with coordinates for d3ccmf1.
(The format of our PDB-style files is described here.)

Timeline for d3ccmf1: