Lineage for d3ccms1 (3ccm S:1-81)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401024Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1401025Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1401026Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 1401027Protein Ribosomal protein L23 [54191] (4 species)
  7. 1401066Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
    Uniprot P12732
  8. 1401080Domain d3ccms1: 3ccm S:1-81 [156348]
    Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccmr1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1, d3ccmz1
    automatically matched to d1jj2r_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccms1

PDB Entry: 3ccm (more details), 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d3ccms1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccms1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOPe Domain Coordinates for d3ccms1:

Click to download the PDB-style file with coordinates for d3ccms1.
(The format of our PDB-style files is described here.)

Timeline for d3ccms1: