Lineage for d3c90b_ (3c90 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927652Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 927653Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 927695Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. 927696Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)
  7. 927715Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [158761] (1 PDB entry)
  8. 927717Domain d3c90b_: 3c90 B: [156061]
    automated match to d1y6xa1

Details for d3c90b_

PDB Entry: 3c90 (more details), 1.79 Å

PDB Description: The 1.25 A Resolution Structure of Phosphoribosyl-ATP Pyrophosphohydrolase from Mycobacterium tuberculosis, crystal form II
PDB Compounds: (B:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d3c90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c90b_ a.204.1.4 (B:) Phosphoribosyl-ATP pyrophosphatase HisE {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
vktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalae
eisqllywtqvlmisrglslddvyrkl

SCOPe Domain Coordinates for d3c90b_:

Click to download the PDB-style file with coordinates for d3c90b_.
(The format of our PDB-style files is described here.)

Timeline for d3c90b_: