SCOPe 2.01: Domain d3c90a_: 3c90 A:

Lineage for d3c90a_ (3c90 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
   Pfam PF01503

6. Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)

7. Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [158761] (1 PDB entry)

8. Domain d3c90a_: 3c90 A: [156060]
   automated match to d1y6xa1

Details for d3c90a_

PDB Entry: 3c90, 1.79 Å

PDB Description: The 1.25 A Resolution Structure of Phosphoribosyl-ATP Pyrophosphohydrolase from Mycobacterium tuberculosis, crystal form II

PDB Compounds: (A:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d3c90a_:

Sequence; same for both SEQRES and ATOM records:

>d3c90a_ a.204.1.4 (A:) Phosphoribosyl-ATP pyrophosphatase HisE {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
vktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalae
eisqllywtqvlmisrglslddvyrkl

Timeline for d3c90a_:

• d3c90a_ first appeared in SCOP 1.75, called d3c90a1
  
• d3c90a_ appears in SCOPe 2.02
  
• d3c90a_ appears in the current release, SCOPe 2.08