Lineage for d3bwuc2 (3bwu C:122-205)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1115534Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1115687Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 1115688Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 1115700Protein FimC [49588] (1 species)
  7. 1115701Species Escherichia coli [TaxId:562] [49589] (6 PDB entries)
  8. 1115702Domain d3bwuc2: 3bwu C:122-205 [155700]
    Other proteins in same PDB: d3bwuc1, d3bwud_
    automatically matched to d1bf8a2
    complexed with edo, peg

Details for d3bwuc2

PDB Entry: 3bwu (more details), 1.76 Å

PDB Description: crystal structure of the ternary complex of fimd (n-terminal domain, fimdn) with fimc and the n-terminally truncated pilus subunit fimf (fimft)
PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d3bwuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwuc2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOPe Domain Coordinates for d3bwuc2:

Click to download the PDB-style file with coordinates for d3bwuc2.
(The format of our PDB-style files is described here.)

Timeline for d3bwuc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bwuc1
View in 3D
Domains from other chains:
(mouse over for more information)
d3bwud_