SCOPe 2.02: Domain d3bwuc1: 3bwu C:1-121

Lineage for d3bwuc1 (3bwu C:1-121)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (5 proteins)

6. Protein Periplasmic chaperone FimC [49358] (1 species)

7. Species Escherichia coli [TaxId:562] [49359] (6 PDB entries)

8. Domain d3bwuc1: 3bwu C:1-121 [155699]
   Other proteins in same PDB: d3bwuc2, d3bwud_
   automatically matched to d1bf8a1
   complexed with edo, peg

Details for d3bwuc1

PDB Entry: 3bwu, 1.76 Å

PDB Description: crystal structure of the ternary complex of fimd (n-terminal domain, fimdn) with fimc and the n-terminally truncated pilus subunit fimf (fimft)

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d3bwuc1:

Sequence, based on SEQRES records:

>d3bwuc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Sequence, based on observed residues (ATOM records):

>d3bwuc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdentlqlaiisriklyyrpakla

Timeline for d3bwuc1:

• d3bwuc1 first appeared in SCOP 1.75
  
• d3bwuc1 appears in SCOPe 2.01
  
• d3bwuc1 appears in SCOPe 2.03
  
• d3bwuc1 appears in the current release, SCOPe 2.08