Lineage for d3bu3a_ (3bu3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981797Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2981798Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries)
  8. 2981799Domain d3bu3a_: 3bu3 A: [155590]
    automated match to d1p14a_

Details for d3bu3a_

PDB Entry: 3bu3 (more details), 1.65 Å

PDB Description: crystal structure of the insulin receptor kinase in complex with irs2 krlb peptide
PDB Compounds: (A:) insulin receptor subunit beta

SCOPe Domain Sequences for d3bu3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bu3a_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

SCOPe Domain Coordinates for d3bu3a_:

Click to download the PDB-style file with coordinates for d3bu3a_.
(The format of our PDB-style files is described here.)

Timeline for d3bu3a_: