Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Transcriptional regulator OEOE1854 [158276] (1 species) |
Species Oenococcus oeni [TaxId:1247] [158277] (1 PDB entry) Uniprot Q04CY6 3-137 |
Domain d3broc_: 3bro C: [155519] automated match to d3broa1 complexed with cl, gol |
PDB Entry: 3bro (more details), 2.04 Å
SCOPe Domain Sequences for d3broc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3broc_ a.4.5.28 (C:) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} dlgrllkiasnqmstrfdifakkydltgtqmtiidylsrnknkevlqrdlesefsiksst atvllqrmeikkllyrkvsgkdsrqkclkltkkankletiilsymdsdqsqmtsglnkee vvflekilkrmiesd
Timeline for d3broc_: