SCOPe 2.02: Domain d3broc_: 3bro C:

Lineage for d3broc_ (3bro C:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Transcriptional regulator OEOE1854 [158276] (1 species)

7. Species Oenococcus oeni [TaxId:1247] [158277] (1 PDB entry)
   Uniprot Q04CY6 3-137

8. Domain d3broc_: 3bro C: [155519]
   automated match to d3broa1
   complexed with cl, gol

Details for d3broc_

PDB Entry: 3bro, 2.04 Å

PDB Description: Crystal structure of the transcription regulator MarR from Oenococcus oeni PSU-1

PDB Compounds: (C:) Transcriptional regulator

SCOPe Domain Sequences for d3broc_:

Sequence; same for both SEQRES and ATOM records:

>d3broc_ a.4.5.28 (C:) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]}
dlgrllkiasnqmstrfdifakkydltgtqmtiidylsrnknkevlqrdlesefsiksst
atvllqrmeikkllyrkvsgkdsrqkclkltkkankletiilsymdsdqsqmtsglnkee
vvflekilkrmiesd

Timeline for d3broc_:

• d3broc_ first appeared in SCOP 1.75, called d3broc1
  
• d3broc_ appears in SCOPe 2.01
  
• d3broc_ appears in SCOPe 2.03
  
• d3broc_ appears in the current release, SCOPe 2.08