Lineage for d3bj2d_ (3bj2 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1977443Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1978109Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries)
    Uniprot P83273; 86% sequence identity
  8. 1978113Domain d3bj2d_: 3bj2 D: [155326]
    Other proteins in same PDB: d3bj2a_, d3bj2c_
    automated match to d1xq5b_
    complexed with ace, hem

Details for d3bj2d_

PDB Entry: 3bj2 (more details), 2 Å

PDB Description: met-Perch Hemoglobin at pH 6.3
PDB Compounds: (D:) hemoglobin beta

SCOPe Domain Sequences for d3bj2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bj2d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

SCOPe Domain Coordinates for d3bj2d_:

Click to download the PDB-style file with coordinates for d3bj2d_.
(The format of our PDB-style files is described here.)

Timeline for d3bj2d_: