Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries) |
Domain d3bhvb1: 3bhv B:171-308 [155285] Other proteins in same PDB: d3bhva1, d3bhva2, d3bhvc1, d3bhvc2 automated match to d3ddqb1 complexed with mg, sgm, var |
PDB Entry: 3bhv (more details), 2.1 Å
SCOPe Domain Sequences for d3bhvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bhvb1 a.74.1.1 (B:171-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq vlrmehlvlkvlafdlaa
Timeline for d3bhvb1: