Lineage for d3bhvb1 (3bhv B:181-308)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772181Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 772182Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 772183Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 772194Protein Cyclin A [47956] (2 species)
  7. 772195Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries)
  8. 772212Domain d3bhvb1: 3bhv B:181-308 [155285]
    automatically matched to d1vina1
    complexed with mg, sgm, var

Details for d3bhvb1

PDB Entry: 3bhv (more details), 2.1 Å

PDB Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor variolin B
PDB Compounds: (B:) Cyclin-A2

SCOP Domain Sequences for d3bhvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bhvb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vlafdlaa

SCOP Domain Coordinates for d3bhvb1:

Click to download the PDB-style file with coordinates for d3bhvb1.
(The format of our PDB-style files is described here.)

Timeline for d3bhvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bhvb2