SCOP 1.75: Domain d3bbou1: 3bbo U:39-136

Lineage for d3bbou1 (3bbo U:39-136)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161278] (2 PDB entries)

8. Domain d3bbou1: 3bbo U:39-136 [155088]
   Other proteins in same PDB: d3bboh1, d3bboo1, d3bbop1
   automatically matched to d1giys_

Details for d3bbou1

PDB Entry: 3bbo, 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome

PDB Compounds: (U:) ribosomal protein l22

SCOP Domain Sequences for d3bbou1:

Sequence; same for both SEQRES and ATOM records:

>d3bbou1 i.1.1.1 (U:39-136) 70S ribosome functional complex {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ismsvdkarrvidqirgrsyaetlmilelmpyracypifkliysaaanashnkqfnkanl
iiskaevnkgitlkkvkprargrsymilrptchitivl

Timeline for d3bbou1:

• d3bbou1 is new in SCOP 1.75
  
• d3bbou1 appears in SCOPe 2.01
  
• d3bbou1 appears in the current release, SCOPe 2.08