Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Nicotiana tabacum [TaxId:4097] [161282] (1 PDB entry) |
Domain d3bbop1: 3bbo P:92-205 [155087] Other proteins in same PDB: d3bbo61, d3bboj1, d3bbok1, d3bbol1, d3bbou1, d3bbov1, d3bbox1 automatically matched to d1nkwl_ |
PDB Entry: 3bbo (more details), 9.4 Å
SCOP Domain Sequences for d3bbop1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbop1 i.1.1.2 (P:92-205) 50S subunit {Nicotiana tabacum [TaxId: 4097]} hgrkvpklnrppdqrrallrglttqllkhgrikttkararavrkyvdkmitmakdgslhk rrqalgfiyekqivhalfaevpdrygernggytriirtlprrgdnapmayielv
Timeline for d3bbop1: