SCOP 1.75: Domain d3bbop1: 3bbo P:92-205

Lineage for d3bbop1 (3bbo P:92-205)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Nicotiana tabacum [TaxId:4097] [161282] (1 PDB entry)

8. Domain d3bbop1: 3bbo P:92-205 [155087]
   Other proteins in same PDB: d3bbo61, d3bboj1, d3bbok1, d3bbol1, d3bbou1, d3bbov1, d3bbox1
   automatically matched to d1nkwl_

Details for d3bbop1

PDB Entry: 3bbo, 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome

PDB Compounds: (P:) ribosomal protein L17

SCOP Domain Sequences for d3bbop1:

Sequence; same for both SEQRES and ATOM records:

>d3bbop1 i.1.1.2 (P:92-205) 50S subunit {Nicotiana tabacum [TaxId: 4097]}
hgrkvpklnrppdqrrallrglttqllkhgrikttkararavrkyvdkmitmakdgslhk
rrqalgfiyekqivhalfaevpdrygernggytriirtlprrgdnapmayielv

Timeline for d3bbop1:

• d3bbop1 is new in SCOP 1.75
  
• d3bbop1 appears in SCOPe 2.01
  
• d3bbop1 appears in the current release, SCOPe 2.08