Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161278] (2 PDB entries) |
Domain d3bbox1: 3bbo X:76-135 [155090] Other proteins in same PDB: d3bboh1, d3bboo1, d3bbop1 automatically matched to d1p85u_ |
PDB Entry: 3bbo (more details), 9.4 Å
SCOP Domain Sequences for d3bbox1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbox1 i.1.1.1 (X:76-135) 70S ribosome functional complex {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} qrlgvkiygdqvakpgaiivrqrgtkfhagknvgigkdhtifslidglvkfekfgpdrkk
Timeline for d3bbox1: