Lineage for d3bboj1 (3bbo J:51-118)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896957Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161278] (2 PDB entries)
  8. 896959Domain d3bboj1: 3bbo J:51-118 [155083]
    Other proteins in same PDB: d3bboh1, d3bboo1, d3bbop1
    automatically matched to d1p85f_

Details for d3bboj1

PDB Entry: 3bbo (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome
PDB Compounds: (J:) ribosomal protein l9

SCOP Domain Sequences for d3bboj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bboj1 i.1.1.1 (J:51-118) 70S ribosome functional complex {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kvilkedvtdlgkqgqlldvkagffrnfllptgkaqlmtplllkelkmederieaekqrv
keeaqqla

SCOP Domain Coordinates for d3bboj1:

Click to download the PDB-style file with coordinates for d3bboj1.
(The format of our PDB-style files is described here.)

Timeline for d3bboj1: