Lineage for d3b6fg1 (3b6f G:15-118)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909269Protein Histone H2A [47115] (7 species)
  7. 909270Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (24 PDB entries)
  8. 909316Domain d3b6fg1: 3b6f G:15-118 [154890]
    Other proteins in same PDB: d3b6fa1, d3b6fb1, d3b6fd1, d3b6fe1, d3b6ff1, d3b6fh1
    automatically matched to d1aoic_
    protein/DNA complex; complexed with mn

Details for d3b6fg1

PDB Entry: 3b6f (more details), 3.45 Å

PDB Description: Nucleosome core particle treated with cisplatin
PDB Compounds: (G:) histone h2a

SCOPe Domain Sequences for d3b6fg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6fg1 a.22.1.1 (G:15-118) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOPe Domain Coordinates for d3b6fg1:

Click to download the PDB-style file with coordinates for d3b6fg1.
(The format of our PDB-style files is described here.)

Timeline for d3b6fg1: