![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins) |
![]() | Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species) contains an extra alpha-helical domain |
![]() | Species SARS coronavirus [TaxId:227859] [89349] (20 PDB entries) |
![]() | Domain d2z9jb1: 2z9j B:2-301 [154255] automatically matched to d1q2wb_ complexed with dms, dtz |
PDB Entry: 2z9j (more details), 1.95 Å
SCOP Domain Sequences for d2z9jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z9jb1 b.47.1.4 (B:2-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs
Timeline for d2z9jb1: