Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species) contains an extra alpha-helical domain |
Species SARS coronavirus [TaxId:227859] [89349] (20 PDB entries) |
Domain d1q2wb_: 1q2w B: [88356] complexed with mpd |
PDB Entry: 1q2w (more details), 1.86 Å
SCOP Domain Sequences for d1q2wb_:
Sequence, based on SEQRES records: (download)
>d1q2wb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} slsgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedll irksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacy ngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdle gkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkyn yepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvr qcs
>d1q2wb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} slsgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictpnyedllirksnh sflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngspsg vyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfygp fvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepltq dhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs
Timeline for d1q2wb_: