Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species) contains an extra alpha-helical domain |
Species SARS coronavirus [TaxId:227859] [89349] (20 PDB entries) |
Domain d2z9ga1: 2z9g A:2-301 [154241] automatically matched to d1q2wb_ complexed with bnz, hg |
PDB Entry: 2z9g (more details), 1.86 Å
SCOP Domain Sequences for d2z9ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z9ga1 b.47.1.4 (A:2-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs
Timeline for d2z9ga1: