PDB entry 2z9g

View 2z9g on RCSB PDB site
Description: Complex structure of SARS-CoV 3C-like protease with PMA
Class: hydrolase
Keywords: complex, ATP-binding, Cytoplasm, Endonuclease, Exonuclease, Helicase, Hydrolase, Membrane, Metal-binding, Nuclease, Nucleotide-binding, Nucleotidyltransferase, Protease, Ribosomal frameshift, RNA replication, RNA-binding, RNA-directed RNA polymerase, Thiol protease, Transferase, Transmembrane, Zinc, Zinc-finger
Deposited on 2007-09-19, released 2007-12-25
The last revision prior to the SCOP 1.75 freeze date was dated 2007-12-25, with a file datestamp of 2007-12-21.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.193
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z9ga1
  • Heterogens: HG, BNZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2z9gA (A:)
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq