Lineage for d1ouua_ (1ouu A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976766Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1977436Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [46494] (2 PDB entries)
  8. 1977438Domain d1ouua_: 1ouu A: [15401]
    Other proteins in same PDB: d1ouub_, d1ouud_
    complexed with cmo, hem

Details for d1ouua_

PDB Entry: 1ouu (more details), 2.5 Å

PDB Description: carbonmonoxy trout hemoglobin i
PDB Compounds: (A:) hemoglobin I

SCOPe Domain Sequences for d1ouua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg
giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp
evhiavdkflaavsaaladkyr

SCOPe Domain Coordinates for d1ouua_:

Click to download the PDB-style file with coordinates for d1ouua_.
(The format of our PDB-style files is described here.)

Timeline for d1ouua_: