Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species) truncated domain 5 lacks the last strand |
Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries) Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864 |
Domain d2vr4b3: 2vr4 B:679-783 [153502] Other proteins in same PDB: d2vr4a4, d2vr4a5, d2vr4b4, d2vr4b5 automatically matched to 2JE8 A:679-783 complexed with 17b, br, cl, edo |
PDB Entry: 2vr4 (more details), 1.8 Å
SCOPe Domain Sequences for d2vr4b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vr4b3 b.1.4.1 (B:679-783) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]} vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq
Timeline for d2vr4b3: