Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries) Uniprot P80374 |
Domain d2vqfi1: 2vqf I:2-128 [153452] Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1 automatically matched to d1fjgi_ complexed with k, mg, par, tm2, zn |
PDB Entry: 2vqf (more details), 2.9 Å
SCOP Domain Sequences for d2vqfi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqfi1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d2vqfi1: