Lineage for d2vqff1 (2vqf F:1-101)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862903Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 862904Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 862905Protein Ribosomal protein S6 [54997] (4 species)
  7. 862935Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 862944Domain d2vqff1: 2vqf F:1-101 [153449]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1
    automatically matched to d1fjgf_
    complexed with k, mg, par, tm2, zn

Details for d2vqff1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (F:) 30S ribosomal protein S6

SCOP Domain Sequences for d2vqff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqff1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d2vqff1:

Click to download the PDB-style file with coordinates for d2vqff1.
(The format of our PDB-style files is described here.)

Timeline for d2vqff1: