Lineage for d2vqfi1 (2vqf I:2-128)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016991Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1016992Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1016993Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1017099Protein Ribosomal protein S9 [54218] (2 species)
  7. 1017127Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 1017129Domain d2vqfi1: 2vqf I:2-128 [153452]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1
    automatically matched to d1fjgi_
    complexed with k, mg, par, zn

Details for d2vqfi1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d2vqfi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfi1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d2vqfi1:

Click to download the PDB-style file with coordinates for d2vqfi1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfi1: