Lineage for d2vqfo1 (2vqf O:2-89)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896972Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 896978Domain d2vqfo1: 2vqf O:2-89 [153458]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfm1, d2vqfn1, d2vqfq1, d2vqfr1, d2vqft1, d2vqfu1
    automatically matched to d1eg0f_
    complexed with k, mg, par, tm2, zn

Details for d2vqfo1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d2vqfo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfo1 i.1.1.1 (O:2-89) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d2vqfo1:

Click to download the PDB-style file with coordinates for d2vqfo1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfo1: